Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO

Cat# NB-21-32562

Size : 100µg

Brand : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q12809
Molecular weight:
26.62 kDa
Pro10–Lys135

Specifications Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO

Product name ARO-P11306-100
Uniprot ID Q12809
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Molecular weight 26.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro10-Lys135
Aliases /Synonyms H-ERG, ERG, HERG, hERG1, hERG-1, Potassium voltage-gated channel subfamily H member 2, ERG-1, KCNH2, Eag homolog, ERG1, Eag-related protein 1, Ether-a-go-go-related gene potassium channel 1, Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related protein 1
Reference ARO-P11306
Note For research use only.
Molecular Constructor
Pro10–Lys135
Product name ARO-P11306-1MG
Uniprot ID Q12809
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Molecular weight 26.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro10-Lys135
Aliases /Synonyms H-ERG, ERG, HERG, hERG1, hERG-1, Potassium voltage-gated channel subfamily H member 2, ERG-1, KCNH2, Eag homolog, ERG1, Eag-related protein 1, Ether-a-go-go-related gene potassium channel 1, Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related protein 1
Reference ARO-P11306
Note For research use only.
Molecular Constructor
Pro10–Lys135
Product name ARO-P11306-50
Uniprot ID Q12809
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Molecular weight 26.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro10-Lys135
Aliases /Synonyms H-ERG, ERG, HERG, hERG1, hERG-1, Potassium voltage-gated channel subfamily H member 2, ERG-1, KCNH2, Eag homolog, ERG1, Eag-related protein 1, Ether-a-go-go-related gene potassium channel 1, Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related protein 1
Reference ARO-P11306
Note For research use only.
Molecular Constructor
Pro10–Lys135

Documents

3D Representation

Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO” Cancel reply

Related products

  • SDS-PAGE for Anti-Human KCNH2/ERG1 Monoclonal Antibody (ABS2068)

    PTX24885

    Anti-Human KCNH2/ERG1 Monoclonal Antibody (ABS2068)