Ambp Antibody - C-terminal region - FITC

Katalog-Nummer ARP59162_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology


Ambp Antibody - C-terminal region : FITC (ARP59162_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-Ambp (ARP59162_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 85%; Goat: 77%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 77%
Peptide SequenceSynthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS
Concentration0.5 mg/ml
Blocking PeptideFor anti-Ambp (ARP59162_P050-FITC) antibody is Catalog # AAP59162
Gene SymbolAmbp
Gene Full Namealpha-1-microglobulin/bikunin precursor
Alias SymbolsUTI
NCBI Gene Id25377
Protein NameProtein AMBP
Description of TargetInter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.
Uniprot IDQ64240
Protein Accession #NP_037033
Nucleotide Accession #NM_012901
Protein Size (# AA)349
Molecular Weight38kDa