Ambp Antibody - C-terminal region - FITC
Referência ARP59162_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Ambp Antibody - C-terminal region : FITC (ARP59162_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-Ambp (ARP59162_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 77%; Dog: 85%; Goat: 77%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Ambp (ARP59162_P050-FITC) antibody is Catalog # AAP59162 |
| Gene Symbol | Ambp |
|---|---|
| Gene Full Name | alpha-1-microglobulin/bikunin precursor |
| Alias Symbols | UTI |
| NCBI Gene Id | 25377 |
| Protein Name | Protein AMBP |
| Description of Target | Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase. |
| Uniprot ID | Q64240 |
| Protein Accession # | NP_037033 |
| Nucleotide Accession # | NM_012901 |
| Protein Size (# AA) | 349 |
| Molecular Weight | 38kDa |
