Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: O43653 Molecular weight: 10.13 kDa Leu12–Ser86 His Datasheet MSDS Specifications PSCA recombinant protein Product name PX-P5184-100 Uniprot ID O43653 Uniprot link https://www.uniprot.org/uniprot/O43653 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS Molecular weight 10.13 kDa Protein delivered with Tag? His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Leu12-Ser86 Protein Accession O43653 Aliases /Synonyms Prostate stem cell antigen Reference PX-P5184 Note For research use only Molecular Constructor Leu12–Ser86 His Product name PX-P5184-1MG Uniprot ID O43653 Uniprot link https://www.uniprot.org/uniprot/O43653 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS Molecular weight 10.13 kDa Protein delivered with Tag? His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Leu12-Ser86 Protein Accession O43653 Aliases /Synonyms Prostate stem cell antigen Reference PX-P5184 Note For research use only Molecular Constructor Leu12–Ser86 His Product name PX-P5184-50 Uniprot ID O43653 Uniprot link https://www.uniprot.org/uniprot/O43653 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS Molecular weight 10.13 kDa Protein delivered with Tag? His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Leu12-Ser86 Protein Accession O43653 Aliases /Synonyms Prostate stem cell antigen Reference PX-P5184 Note For research use only Molecular Constructor Leu12–Ser86 His Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “PSCA recombinant protein” Cancel reply
There are no reviews yet.