PX-TA1121
Formaat : 100ug
| Product name | PX-P5184-100 |
|---|---|
| Uniprot ID | O43653 |
| Uniprot link | https://www.uniprot.org/uniprot/O43653 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Molecular weight | 10.13 kDa |
| Protein delivered with Tag? | His Tag |
| Purity estimated | >90% as determined by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu12-Ser86 |
| Protein Accession | O43653 |
| Aliases /Synonyms | Prostate stem cell antigen |
| Reference | PX-P5184 |
| Note | For research use only |
| Molecular Constructor | Leu12–Ser86 His |
| Product name | PX-P5184-1MG |
|---|---|
| Uniprot ID | O43653 |
| Uniprot link | https://www.uniprot.org/uniprot/O43653 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Molecular weight | 10.13 kDa |
| Protein delivered with Tag? | His Tag |
| Purity estimated | >90% as determined by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu12-Ser86 |
| Protein Accession | O43653 |
| Aliases /Synonyms | Prostate stem cell antigen |
| Reference | PX-P5184 |
| Note | For research use only |
| Molecular Constructor | Leu12–Ser86 His |
| Product name | PX-P5184-50 |
|---|---|
| Uniprot ID | O43653 |
| Uniprot link | https://www.uniprot.org/uniprot/O43653 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Molecular weight | 10.13 kDa |
| Protein delivered with Tag? | His Tag |
| Purity estimated | >90% as determined by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu12-Ser86 |
| Protein Accession | O43653 |
| Aliases /Synonyms | Prostate stem cell antigen |
| Reference | PX-P5184 |
| Note | For research use only |
| Molecular Constructor | Leu12–Ser86 His |
There are no reviews yet.