RBPJ Peptide - middle region
Katalog-Nummer orb1997927-100ug
Size : 100ug
Marke : Biorbyt
Description
Key Properties
−| Protein Sequence | Synthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN |
|---|
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa
−
Quick Database Links
UniProt
RefSeq (Protein):NP_001074396.1
UniProt Details
− Loading UniProt data...
NCBI Reference Sequences
−.carousel__track {display: flex;} .carousel__track li {list-style: none;}.product-image {display: flex;align-items: center;}.product-image-wrapper {width: 21%;}.product-image-description {width: 90%;}#reviews {display: none;}


