RBPJ Peptide - middle region

Referentie orb1997927-100ug

Formaat : 100ug

Merk : Biorbyt


RBPJ Peptide - middle region

SKU: orb1997927

Description

RBPJ Peptide - middle region, also known as CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa, corresponds to the sequence CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN and is supplied as a lyophilized powder. This peptide is for research use only.

Images & Validation

Key Properties

Protein SequenceSynthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa

UniProt Details

Loading UniProt data...

NCBI Reference Sequences

.carousel__track {display: flex;} .carousel__track li {list-style: none;}.product-image {display: flex;align-items: center;}.product-image-wrapper {width: 21%;}.product-image-description {width: 90%;}#reviews {display: none;}