Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie
 
> Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

Drucken Drucken
Melden Sie sich an

Katalog-Nummer TP321254M

Size : 100ug


Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321254M
Recombinant protein of human tryptophan hydroxylase 1 (TPH1), 100 µg
 

Other products for "Tryptophan Hydroxylase or NM_004179"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221254 representing NM_004179
Red=Cloning site Green=Tags(s)

MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINR
EQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNV
YRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDN
IPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPL
LAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAK
VKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA
MNELQHDLDVVSDALAKVSRKPSI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004170
Locus ID 7166
UniProt ID P17752
Cytogenetics 11p15.1
RefSeq Size 1335
RefSeq ORF 1332
Synonyms TPRH; TRPH
Summary This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others.provided by RefSeq, Apr 2009
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Tryptophan metabolism
FAQs
  • Protein FAQs
SDS

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Sie könnten auch an folgenden Produkten interessiert sein:



Katalog-Nummer
Beschreibung
Cond.
Preis zzgl. MwSt.
9040-05
Mouse Anti-Human IgG Fc-HRP
 1.0mL