SEC14L1 Antibody - N-terminal region - FITC

Katalog-Nummer ARP65502_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology


SEC14L1 Antibody - N-terminal region : FITC (ARP65502_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-SEC14L1 (ARP65502_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human SEC14L1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN
Concentration0.5 mg/ml
Blocking PeptideFor anti-SEC14L1 (ARP65502_P050-FITC) antibody is Catalog # AAP65502
Gene SymbolSEC14L1
Gene Full NameSEC14-like 1 (S. cerevisiae)
Alias SymbolsSEC14L, PRELID4A
NCBI Gene Id6397
Protein NameSEC14-like protein 1
Description of TargetThe protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene; some variants represent read-through transcripts that include exons from the upstream gene C17orf86.
Uniprot IDQ92503
Protein Accession #NP_001137473
Nucleotide Accession #NM_001144001
Protein Size (# AA)681
Molecular Weight77kDa
Protein InteractionsUBC; EPB41;

Sie könnten auch an folgenden Produkten interessiert sein:



Katalog-Nummer
Beschreibung
Cond.
Preis zzgl. MwSt.
102-27684
 400uL 
ARP65502_P050-25UL
 25ul