NB-21-38860 | Anti-HMPV M2/Protein M2-2 Polyclonal Antibody Clinisciences

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Anti-HMPV M2/Protein M2-2 Polyclonal Antibody binds to Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His in WB Assay

Datasheet

Specifications Anti-HMPV M2/Protein M2-2 Polyclonal Antibody

Product name	ARO-A13491-100
Uniprot ID	Q6WB96
Raw Antigen Sequence	TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Protein M2-2, M2, Human metapneumovirus (strain CAN97-83) (HMPV)
Reference	ARO-A13491
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant HMPV M2/Protein M2-2 (Thr2-Ser71).

Product name	ARO-A13491-1MG
Uniprot ID	Q6WB96
Raw Antigen Sequence	TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Protein M2-2, M2, Human metapneumovirus (strain CAN97-83) (HMPV)
Reference	ARO-A13491
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant HMPV M2/Protein M2-2 (Thr2-Ser71).

Product name	ARO-A13491-50
Uniprot ID	Q6WB96
Raw Antigen Sequence	TLHMPCKTVKALIKCSEHGPVFITIEVDEMIWTQKELKEALSDGIVKSHTNIYNCYLENIEIIYVKAYLS
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Protein M2-2, M2, Human metapneumovirus (strain CAN97-83) (HMPV)
Reference	ARO-A13491
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant HMPV M2/Protein M2-2 (Thr2-Ser71).

Documents

Datasheet

QC & Validation

Anti-HMPV M2/Protein M2-2 Polyclonal Antibody binds to Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His in WB Assay

Recombinant HMPV M2/Protein M2-2 Protein, N-GST & C-His(cat. No.ARO-P15733) can bind Anti-HMPV M2/Protein M2-2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Anti-HMPV M2/Protein M2-2 Polyclonal Antibody” Cancel reply

Anti-HMPV M2/Protein M2-2 Polyclonal Antibody

Katalog-Nummer NB-21-38860

Marke : Neo Biotech