Bovine tracheal antimicrobial peptide

Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively^[1].

4084.98

C₁₆₉H₂₉₆N₅₈O₄₅S₇

Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met-Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge:C5-C34,C12-C27,C17-C35)

NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK (Disulfide bridge:C5-C34,C12-C27,C17-C35)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Diamond G, et al. Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA. Proc Natl Acad Sci U S A. 1991 May 1;88(9):3952-6.  [Content Brief]