MYH1 antibody - N-terminal region
Cat# ARP42269_P050
Size : 100ul
Marca : Aviva Systems Biology
MYH1 Antibody - N-terminal region (ARP42269_P050)
| Datasheets/Manuals | Printable datasheet for anti-MYH1 (ARP42269_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MYH1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MYH1 (ARP42269_P050) antibody is Catalog # AAP42269 (Previous Catalog # AAPP24688) |
| Sample Type Confirmation | MYH1 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Enhanced Validation |
| Reference | Avezzu,A., (er) Cancer Lett. (2008) In press |
|---|---|
| Gene Symbol | MYH1 |
| Gene Full Name | Myosin, heavy chain 1, skeletal muscle, adult |
| Alias Symbols | MYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D |
| NCBI Gene Id | 4619 |
| Protein Name | Myosin-1 |
| Description of Target | Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin hea |
| Uniprot ID | P12882 |
| Protein Accession # | NP_005954 |
| Nucleotide Accession # | NM_005963 |
| Protein Size (# AA) | 1939 |
| Molecular Weight | 223 kDa |
| Protein Interactions | KRT13; WWOX; PIK3C3; ARRB1; UBC; STAU1; |






