MYH1 antibody - N-terminal region

Referentie ARP42269_P050

Formaat : 100ul

Merk : Aviva Systems Biology


MYH1 Antibody - N-terminal region (ARP42269_P050)

Datasheets/ManualsPrintable datasheet for anti-MYH1 (ARP42269_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MYH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK
Concentration0.5 mg/ml
Blocking PeptideFor anti-MYH1 (ARP42269_P050) antibody is Catalog # AAP42269 (Previous Catalog # AAPP24688)
Sample Type Confirmation

MYH1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Enhanced Validation
Relative Expression (Western Blot)
Avivasheild
ReferenceAvezzu,A., (er) Cancer Lett. (2008) In press
Gene SymbolMYH1
Gene Full NameMyosin, heavy chain 1, skeletal muscle, adult
Alias SymbolsMYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D
NCBI Gene Id4619
Protein NameMyosin-1
Description of TargetMyosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin hea
Uniprot IDP12882
Protein Accession #NP_005954
Nucleotide Accession #NM_005963
Protein Size (# AA)1939
Molecular Weight223 kDa
Protein InteractionsKRT13; WWOX; PIK3C3; ARRB1; UBC; STAU1;

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
ARP41380_P050
 100ul 
126-10133
 100ug 
ARP38413_P050
 100ul