Serpinh1 Blocking peptie (Middle region)

Cat# AAP90134

Size : 100ug

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

SERPINH1 Peptide - middle region (AAP90134)

Data Sheet
 
Sku AAP90134
99
Name SERPINH1 Peptide - middle region (AAP90134)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SERPINH1
Alias symbols J6, Cbp1, Cbp2, gp46, Hsp47, BERF-1, Serpinh2
Gene id 12406
Description of target Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen.
Swissprot id P19324
Protein accession num NP_001104513.1
Nucleotide accession num NM_001111043.1
Protein size 417 amino acids
Molecular weight 45 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: VTRSYTVGVTMMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHV
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- SERPINH1 Antibody (ARP90134_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com