AFG3L2 Antibody - middle region

Referentie ARP46780_P050-25UL

Formaat : 25ul

Merk : Aviva Systems Biology


AFG3L2 Antibody - middle region (ARP46780_P050)

Datasheets/ManualsPrintable datasheet for anti-AFG3L2 (ARP46780_P050) antibody
Product Info
Publications

Depletion of mitochondrial protease OMA1 alters proliferative properties and promotes metastatic growth of breast cancer cells

Authors: Daverey, A., Levytskyy, R. M., et al.

Journal: Sci Rep. 9, 14746 (2019)

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AFG3L2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS
Concentration0.5 mg/ml
Blocking PeptideFor anti-AFG3L2 (ARP46780_P050) antibody is Catalog # AAP46780 (Previous Catalog # AAPP27579)
Sample Type Confirmation

AFG3L2 is supported by BioGPS gene expression data to be expressed in HeLa

ReferenceBanfi,S., (1999) Genomics 59 (1), 51-58
Gene SymbolAFG3L2
Gene Full NameAFG3 ATPase family gene 3-like 2 (S. cerevisiae)
Alias SymbolsOPA12, SCA28, SPAX5
NCBI Gene Id10939
Protein NameAFG3-like protein 2
Description of TargetAFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
Uniprot IDQ9Y4W6
Protein Accession #NP_006787
Nucleotide Accession #NM_006796
Protein Size (# AA)797
Molecular Weight88kDa
Protein InteractionsSUMO2; UBC; SUZ12; RNF2; HIPK4; FBXO6; BTK; APP; MAPK8IP2; RAC2; ICT1; BECN1; CLN3; USP50; PHC2;