AFG3L2 Antibody - middle region
Cat# ARP46780_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
AFG3L2 Antibody - middle region (ARP46780_P050)
| Datasheets/Manuals | Printable datasheet for anti-AFG3L2 (ARP46780_P050) antibody |
|---|
| Publications | Depletion of mitochondrial protease OMA1 alters proliferative properties and promotes metastatic growth of breast cancer cells |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AFG3L2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AFG3L2 (ARP46780_P050) antibody is Catalog # AAP46780 (Previous Catalog # AAPP27579) |
| Sample Type Confirmation | AFG3L2 is supported by BioGPS gene expression data to be expressed in HeLa |
| Reference | Banfi,S., (1999) Genomics 59 (1), 51-58 |
|---|---|
| Gene Symbol | AFG3L2 |
| Gene Full Name | AFG3 ATPase family gene 3-like 2 (S. cerevisiae) |
| Alias Symbols | OPA12, SCA28, SPAX5 |
| NCBI Gene Id | 10939 |
| Protein Name | AFG3-like protein 2 |
| Description of Target | AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. |
| Uniprot ID | Q9Y4W6 |
| Protein Accession # | NP_006787 |
| Nucleotide Accession # | NM_006796 |
| Protein Size (# AA) | 797 |
| Molecular Weight | 88kDa |
| Protein Interactions | SUMO2; UBC; SUZ12; RNF2; HIPK4; FBXO6; BTK; APP; MAPK8IP2; RAC2; ICT1; BECN1; CLN3; USP50; PHC2; |
