CROCCL2 Antibody - N-terminal region

Referentie ARP51734_P050-25UL

Formaat : 25ul

Merk : Aviva Systems Biology


CROCCL2 Antibody - N-terminal region (ARP51734_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CROCCP3 (ARP51734_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CROCCL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 83%; Human: 92%; Mouse: 85%; Pig: 92%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CROCCP3 (ARP51734_P050) antibody is Catalog # AAP51734 (Previous Catalog # AAPP40234)
Gene SymbolCROCCP3
Gene Full NameCiliary rootlet coiled-coil, rootletin pseudogene 3
Alias SymbolsCROCCL2, dJ798A10.2
NCBI Gene Id114819
Protein NamePutative ciliary rootlet coiled-coil protein-like 2 protein
Description of TargetCROCCL2 belongs to the rootletin family. The exact functions of CROCCL2 remain unknown.
Uniprot IDQ8IVE0
Protein Accession #XP_057040
Nucleotide Accession #XM_057040
Protein Size (# AA)415
Molecular Weight47kDa
  1. What is the species homology for "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CROCCL2 Antibody - N-terminal region (ARP51734_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?

    This target may also be called "CROCCL2, dJ798A10.2" in publications.

  5. What is the shipping cost for "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "CROCCL2 Antibody - N-terminal region (ARP5

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
CSB-PA887985LA01HU-50ug
 50ug 
A4398-20
 20uL