CROCCL2 Antibody - N-terminal region
Referencia ARP51734_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
CROCCL2 Antibody - N-terminal region (ARP51734_P050)
| Datasheets/Manuals | Printable datasheet for anti-CROCCP3 (ARP51734_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CROCCL2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 100%; Guinea Pig: 83%; Human: 92%; Mouse: 85%; Pig: 92%; Rabbit: 100%; Rat: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CROCCP3 (ARP51734_P050) antibody is Catalog # AAP51734 (Previous Catalog # AAPP40234) |
| Gene Symbol | CROCCP3 |
|---|---|
| Gene Full Name | Ciliary rootlet coiled-coil, rootletin pseudogene 3 |
| Alias Symbols | CROCCL2, dJ798A10.2 |
| NCBI Gene Id | 114819 |
| Protein Name | Putative ciliary rootlet coiled-coil protein-like 2 protein |
| Description of Target | CROCCL2 belongs to the rootletin family. The exact functions of CROCCL2 remain unknown. |
| Uniprot ID | Q8IVE0 |
| Protein Accession # | XP_057040 |
| Nucleotide Accession # | XM_057040 |
| Protein Size (# AA) | 415 |
| Molecular Weight | 47kDa |
-
What is the species homology for "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit".
-
How long will it take to receive "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CROCCL2 Antibody - N-terminal region (ARP51734_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?
This target may also be called "CROCCL2, dJ798A10.2" in publications.
-
What is the shipping cost for "CROCCL2 Antibody - N-terminal region (ARP51734_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "CROCCL2 Antibody - N-terminal region (ARP5


