CTSL1 Blocking peptie (Middle region)

Referentie AAP97803

Formaat : 100ug

Merk : Aviva Systems Biology

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

CTSL Peptide - middle region (AAP97803)

Data Sheet
 
Sku AAP97803
99
Name CTSL Peptide - middle region (AAP97803)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CTSL
Alias symbols MEP, CATL, CTSL1
Gene id 1514
Description of target The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Multiple alternatively spliced transcript variants have been found for this gene.
Swissprot id P07711
Protein accession num NP_001244900.1
Nucleotide accession num NM_001257971.1
Protein size 333 amino acids
Molecular weight 36 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: KEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMG
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- CTSL1 Antibody (ARP97803_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com