Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> CD91 Recombinant Protein

CD91 Recombinant Protein

Imprimir Imprimir
Please log in

Referência NB-21-24438

Tamanho : 100ug

Marca : Neo Biotech


CD91 Recombinant Protein

Product name PX-P4094-100
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 37kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Host species Escherichia coli (E.coli)
Fragment Type Ala20~Gly292
Aliases /Synonyms A2MR,APR
Reference PX-P4094
Note For research use only
Molecular Constructor
His Ala20~Gly292