- Host species:
- Escherichia coli (E.coli)
- Origin species:
- Human
- Uniprot ID:
- P26358
- Molecular weight:
- 22.56 kDa
ARO-A15145
Tamanho : 100µg
It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg">End-to-end solutions from antigen design to bioproduction
Guaranteed high-affinity and blocking fully
human antibodies
Characterize your antibodies in terms of
sequence, structure and function
Increase the affinity, improve the developability or humanize your antibody in just 3 weeks
Transform your antibodies into ADCs, bispecifics...
From high-throughput screening to large-scale production
Discover how VHH antibodies can accelerate the development of next-generation cancer therapeutics.
Access a unique repertoire derived from 86 cancer patients and accelerate your discovery program.
Guaranteed high-detection antibodies that works in your hands
11 applications including ELISA, WB, FC, immunoprecipitation...
From various species: mouse, rat, rabbit, goat, sheep, chicken, llama, alpaca...
From high-throughput screening to large-scale production
Discover our 1mg guaranteed high-throughput antibody production service.
Order them at best without any comprise on quality with our recombinant antibody production service.
Guaranteed high affinity blocking antibodies for cat and dogs therapeutics
From high-throughput screening to large-scale production
Discover our 1mg guaranteed high-throughput antibody production service.
Order them at best without any comprise on quality with our recombinant antibody production service.
Generate up to 2 mg of dozens of biologics with our high-throughput production platform
Produce mg to gram-scale of protein in one of our 5 expression systems
Produce gram to kg-scale of protein with our stable cell line development platform
Improve your protein production yield up to 50 times
Characterize your proteins in terms of structure, activity, stability...
Discover our 1mg guaranteed high-throughput antibody production service.
Order them at best without any comprise on quality with our recombinant antibody production service.
Synthesize one to thousand peptides from mg to gram-scale - From /AA
Build your antibody library using a variety of strategies, including overlapping, alanine scanning, and positional scanning...
Order instantly your genes with 100% sequence guaranteed - From /bp
6,000+ primary antibodies targeting various therapeutic targets, including GPCRs, immune checkpoints, and more
6,000+ recombinant proteins, including membrane proteins in micelles or nanodiscs
Discover a large catalog of ELISA assay kits specially designed for the detection of various antibodies or antigens
Our in-house transient CHO expression system setting new records
Need a fast and cost-effective solution to produce your proteins? Discover XtenCHOTM Race and achieve multi-gram protein production in just 8 days.
Discover our catalog of ready-to-use proteins in micelles or nanodiscs.
A science-driven partner accelerating your therapeutic and diagnostic breakthroughs.
We put responsibility at the heart of innovation for sustainable science
We make science faster, smarter and more predictable
Connecting in silico intelligence to in vitro validation
Choose more than a service provider, choose a partner
Proprietary platforms powering faster and more reliable development workflows.
Your AI Antibody Design Platform designed to optimize your antibody in weeks
Discover one of the largest catalog of antibody libraries and get high-affinity antibodies in 1 month
Our high-performance mammalian expression system
High speed immunization platform - Up to 50% faster than competitors
From discovery to production, across industries
End-to-end solutions from antigen design to
bioproduction
Innovative solutions to accelerate your immuno-oncology program.
Guaranteed solutions to detect and quantify
your analytes
Unique solutions to create new animal
biotherapeutics
Discover inspiring success stories and case reports from real-world projects
Discover how phage display allowed to identify 130 antibody sequences for a CAR-T project.
Learn how we generated 4 unique antibodies against a melanoma-associated pHLA target.
Discover how we delivered 14 VHH targeting PD-1 in just 3 weeks.
Learn how our multi-format screening approach led to high-affinity antibodies.
Your hub for insights: webinars, blogs, and whitepapers from ProteoGenix
Discover a lot of tips and advices for your biologics development
Our experts share their knowledge to stay at the forefront of trending scientific topics.
Access a wealth of knowledge on biologics development
Tools to guide, calculate, and order your projects
Need to produce antibodies? Take 2 minutes and get your quote in 4 hours
Take 2 minutes to find out the best antibody development methode for your project.
Order your peptide in 2 minutes thanks to our interactive form
Order your gene in 2 minutes thanks to our interactive form
📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program
Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
| Product name | ARO-P12602-100 |
|---|---|
| Uniprot ID | P26358 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI |
| Molecular weight | 22.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg730-Ile907 |
| Aliases /Synonyms | CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9 |
| Reference | ARO-P12602 |
| Note | For research use only. |
| Molecular Constructor | Arg730–Ile907 |
| Product name | ARO-P12602-1MG |
|---|---|
| Uniprot ID | P26358 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI |
| Molecular weight | 22.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg730-Ile907 |
| Aliases /Synonyms | CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9 |
| Reference | ARO-P12602 |
| Note | For research use only. |
| Molecular Constructor | Arg730–Ile907 |
| Product name | ARO-P12602-50 |
|---|---|
| Uniprot ID | P26358 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI |
| Molecular weight | 22.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg730-Ile907 |
| Aliases /Synonyms | CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9 |
| Reference | ARO-P12602 |
| Note | For research use only. |
| Molecular Constructor | Arg730–Ile907 |
There are no reviews yet.