Recombinant Human DNMT1 Protein, N-His

Cat# NB-21-31181

Size : 100µg

Brand : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P26358
Molecular weight:
22.56 kDa
Arg730–Ile907

Specifications Recombinant Human DNMT1 Protein, N-His

Product name ARO-P12602-100
Uniprot ID P26358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg730-Ile907
Aliases /Synonyms CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9
Reference ARO-P12602
Note For research use only.
Molecular Constructor
Arg730–Ile907
Product name ARO-P12602-1MG
Uniprot ID P26358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg730-Ile907
Aliases /Synonyms CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9
Reference ARO-P12602
Note For research use only.
Molecular Constructor
Arg730–Ile907
Product name ARO-P12602-50
Uniprot ID P26358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg730-Ile907
Aliases /Synonyms CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9
Reference ARO-P12602
Note For research use only.
Molecular Constructor
Arg730–Ile907

Documents

QC & Validation

SDS-PAGE for Recombinant Human DNMT1 Protein, N-His

SDS-PAGE for Recombinant Human DNMT1 Protein, N-His

Recombinant Human DNMT1 Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Recombinant Human DNMT1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human DNMT1 Protein, N-His” Cancel reply

Related products

  • SDS-PAGE for Human DNMT1 IP Monoclonal Antibody SAA0251

    ARO-A15145

    Anti-Human DNMT1 IP Antibody (SAA0251)