synthetic construction IA-2 Recombinant Protein

Referência NB-21-25205

Tamanho : 50ug

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
synthetic construction
Uniprot ID:
Q7KZS4
Molecular weight:
44.72kDa
Partial Yes

Specifications synthetic construction IA-2 Recombinant Protein

Product name synthetic construction IA-2 Recombinant Protein
Uniprot ID Q7KZS4
Uniprot link http://www.uniprot.org/uniprot/Q7KZS4
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLLEVLFQGPHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
Molecular weight 44.72kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer Tris 50mMHCl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH 7
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAP36361.1
Spec:SwissProtID Q7KZS4
NCBI Reference AAP36361.1
Aliases /Synonyms IA-2, Protein-tyrosine-phosphatase
Reference PX-P2076
Note For research use only
Molecular Constructor
Partial Yes
Product name synthetic construction IA-2 Recombinant Protein
Uniprot ID Q7KZS4
Uniprot link http://www.uniprot.org/uniprot/Q7KZS4
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLLEVLFQGPHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
Molecular weight 44.72kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer Tris-HC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH 7
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAP36361.1
Spec:SwissProtID Q7KZS4
NCBI Reference AAP36361.1
Aliases /Synonyms IA-2, Protein-tyrosine-phosphatase
Reference PX-P2076
Note For research use only
Molecular Constructor
Partial Yes

Documents

Reviews

There are no reviews yet.

Be the first to review “synthetic construction IA-2 Recombinant Protein” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call