Svs5 Blocking peptide (Middle region)

Referência AAP95648

Tamanho : 100ug

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

LOC103694892 Peptide - middle region (AAP95648)

Data Sheet
 
Sku AAP95648
99
Name LOC103694892 Peptide - middle region (AAP95648)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene LOC103694892
Alias symbols Svp5
Gene id 103694892
Swissprot id P04812
Protein accession num NP_598200.1
Nucleotide accession num NM_133516.2
Protein size 123 amino acids
Molecular weight 13 kDa
Species reactivity Rat
Peptide sequence Synthetic peptide located within the following region: VLVTEAASRGPREKFSQSAEDPYSENMNLKILASGRGSSSTFGAFSRSEN
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- SVS5 Antibody (ARP95648_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com