Adrenocorticotropic hormone [9002-60-2]
Cat# HY-106373-25mg
Size : 25mg
Brand : MedChemExpress
| Description |
Adrenocorticotropic hormone (ACTH; Adrenocorticotrophic hormone) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone stimulates cortisol secretion from the adrenal cortex via the hypothalamic-pituitary-adrenal (HPA) axis. Adrenocorticotropic hormone regulates cortisol and androgen production. Adrenocorticotropic hormone can promote the development of spermatogenesis. Adrenocorticotropic hormone can relieve acute inflammation in gout models by inhibiting the polarization of macrophages to M1 type, inhibiting ROS and proinflammatory factor production and protecting mitochondrial function. Adrenocorticotropic hormone can be used for the researches of inflammation, endocrinology, metabolic disease, such as gout and nephrotic syndrome[1][2][3][4]. |
||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| IC50 & Target[3] |
|
||||||||||||
| In Vitro |
Adrenocorticotropic hormone (100 nM, 5weeks) induces clusters development of spermatogenesis isolated from mouse seminiferous tubules and significantly increases the proportion of pre-meiotic cells (CDH-1, VASA, MC2R-positive) and the expression of PLZF, VASA, MC2R, THY-1 genes[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. |
||||||||||||
| In Vivo |
Adrenocorticotropic hormone (0.25-2.5 U/mL, s.c., 30 minutes after MSU intra-articular injection) significantly alleviates joint swelling, reduces inflammatory cell infiltration in joint tissues, and has no significant effect on serum cortisol levels in gout mice models[3]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
|
||||||||||||
| Clinical Trial |
|
||||||||||||
| Molecular Weight |
4541.14 |
||||||||||||
| Formula |
C207H308N56O58S |
||||||||||||
| CAS No. | |||||||||||||
| Appearance |
Solid |
||||||||||||
| Color |
White to off-white |
||||||||||||
| Sequence |
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
||||||||||||
| Sequence Shortening |
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
||||||||||||
| Shipping | Room temperature in continental US; may vary elsewhere. |
||||||||||||
| Storage |
Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||||||||
| Solvent & Solubility |
In Vitro:
DMSO : 50 mg/mL (11.01 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO) Preparing
Stock Solutions
View the Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol) Concentration (start) × Volume (start) = Concentration (final) × Volume (final) This equation is commonly abbreviated as: C1V1 = C2V2 In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
Dosage mg/kgAnimal weight Dosing volume Number of animals Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration:
mg/mL
|
||||||||||||
| Purity & Documentation | |||||||||||||
| References |
|

