Reagents and instruments for immunology, cell biology and molecular biology.
 
> Anti-Human KCNA3 Polyclonal Antibody

Anti-Human KCNA3 Polyclonal Antibody

Print Print
Please log in

Cat# NB-21-37523

Size : 100µg

Brand : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG
Anti-Human KCNA3 Polyclonal Antibody binds to Recombinant Human KCNA3 Protein, N-His in WB Assay

Specifications Anti-Human KCNA3 Polyclonal Antibody

Product name PTX20241-100
Uniprot ID P22001
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-KCNA3
Isotype IgG
Clonality Polyclonal Antibody
Protein Name KCNA3
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000
Product name PTX20241-1MG
Uniprot ID P22001
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-KCNA3
Isotype IgG
Clonality Polyclonal Antibody
Protein Name KCNA3
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000
Product name PTX20241-50
Uniprot ID P22001
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-KCNA3
Isotype IgG
Clonality Polyclonal Antibody
Protein Name KCNA3
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Documents

QC & Validation

Anti-Human KCNA3 Polyclonal Antibody binds to Recombinant Human KCNA3 Protein, N-His in WB Assay

Anti-Human KCNA3 Polyclonal Antibody binds to Recombinant Human KCNA3 Protein, N-His in WB Assay

Recombinant Human KCNA3 Protein, N-His(cat. No.ARO-P11766) can bind Anti-Human KCNA3 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human KCNA3 Polyclonal Antibody” Cancel reply

Related products

  • Recombinant Human KCNA3 Protein, N-His

    ARO-P11766

    Recombinant Human KCNA3 Protein, N-His