CD109 Antibody - middle region : FITC
Cat# ARP64139_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
CD109 Antibody - middle region : FITC (ARP64139_P050-FITC)
Datasheets/Manuals | Printable datasheet for anti-CD109 (ARP64139_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CD109 (ARP64139_P050-FITC) antibody is Catalog # AAP64139 |
Gene Symbol | CD109 |
---|---|
Gene Full Name | CD109 molecule |
Alias Symbols | p180, r150, CPAMD7 |
NCBI Gene Id | 135228 |
Protein Name | CD109 antigen |
Description of Target | This gene encodes a member of the alpha2-macroglobulin/complement superfamily. The encoded GPI-linked glycoprotein is found on the cell surface of platelets, activated T-cells, and endothelial cells. The protein binds to and negatively regulates signaling of transforming growth factor beta (TGF-beta). Multiple transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | Q6YHK3-2 |
Protein Accession # | NP_001153060 |
Nucleotide Accession # | NM_001159588 |
Protein Size (# AA) | 1368 |
Molecular Weight | 151kDa |