CD109 Antibody - middle region : FITC

Cat# ARP64139_P050-FITC

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

Aviva Systems Biology will be closed on Friday, July 4th, in observance of Independence Day.

CD109 Antibody - middle region : FITC (ARP64139_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-CD109 (ARP64139_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD109 (ARP64139_P050-FITC) antibody is Catalog # AAP64139
Gene SymbolCD109
Gene Full NameCD109 molecule
Alias Symbolsp180, r150, CPAMD7
NCBI Gene Id135228
Protein NameCD109 antigen
Description of TargetThis gene encodes a member of the alpha2-macroglobulin/complement superfamily. The encoded GPI-linked glycoprotein is found on the cell surface of platelets, activated T-cells, and endothelial cells. The protein binds to and negatively regulates signaling of transforming growth factor beta (TGF-beta). Multiple transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ6YHK3-2
Protein Accession #NP_001153060
Nucleotide Accession #NM_001159588
Protein Size (# AA)1368
Molecular Weight151kDa