GFP-like Non-Fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, GST-Tag

Cat# 584662-100ug

Size : 100ug

Brand : US Biological



584662 GFP-like Non-Fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, GST-Tag

Swiss Prot
Q9GZ28
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Pigment protein that is intensely purple in color.

Source:
Recombinant protein corresponding to aa1-62 from Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595, fused to GST-Tag at N-terminal, expressed in E.coli.

Molecular Weight:
~33.5kD

Amino Acid Sequence:
MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)