GTF2F1 Antibody - N-terminal region - FITC
Cat# ARP38104_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
GTF2F1 Antibody - N-terminal region : FITC (ARP38104_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-GTF2F1 (ARP38104_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2F1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90% |
| Peptide Sequence | Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GTF2F1 (ARP38104_P050-FITC) antibody is Catalog # AAP38104 (Previous Catalog # AAPP20278) |
| Sample Type Confirmation | GTF2F1 is strongly supported by BioGPS gene expression data to be expressed in HT1080 |
| Subunit | 1 |
| Reference | Lavery,D.N. (2008) Biochemistry 47 (11), 3352-3359 |
|---|---|
| Gene Symbol | GTF2F1 |
| Gene Full Name | General transcription factor IIF, polypeptide 1, 74kDa |
| Alias Symbols | BTF4, RAP74, TF2F1, TFIIF |
| NCBI Gene Id | 2962 |
| Protein Name | General transcription factor IIF subunit 1 |
| Description of Target | GTF2F1 is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. |
| Uniprot ID | P35269 |
| Protein Accession # | NP_002087 |
| Nucleotide Accession # | NM_002096 |
| Protein Size (# AA) | 517 |
| Molecular Weight | 58kDa |
| Protein Interactions | ABL1; UBC; tat; PUS1; DUS3L; VPS29; SNF8; PSAP; BCAT1; TCEA1; GTF2B; POLR2C; GTF2F2; CDC73; MMS19; SF3A3; SRSF9; COIL; SNRPA; POLR2A; EEF1B2; CIRBP; CDK9; POLR2D; GTF2H1; GTF2E1; ERCC2; CDK8; CCNC; MAGEC1; TAF1; HNRNPU; FCP1; CSNK2A1; CCNT1; Gtf3c6; POLR2 |
