MBP antibody - middle region

Cat# ARP56224_P050

Size : 100ul

Brand : Aviva Systems Biology


Aviva Systems Biology will be closed on Friday, July 3rd, in observance of Independence Day.
Datasheets/ManualsPrintable datasheet for anti-MBP (ARP56224_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, IP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MBP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 80%; Dog: 87%; Guinea Pig: 79%; Horse: 80%; Human: 100%; Mouse: 93%; Pig: 80%; Rabbit: 93%; Rat: 87%
Peptide SequenceSynthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
Concentration0.5 mg/ml
Blocking PeptideFor anti-MBP (ARP56224_P050) antibody is Catalog # AAP56224 (Previous Catalog # AAPP38142)
Other Applications Image 1 DataIP Suggested Anti-MBP Antibody
Positive Control: NT2 CELL/BRAIN TISSUE
Other Applications Image 2 DataIP Suggested Anti-MBP antibody
Titration: 2 ug/ml
Positive Control: Rat brain homogenate
ReferenceZhang,Q.Y., (2008) Arch. Med. Res. 39 (1), 45-51
Gene SymbolMBP
Gene Full NameMyelin basic protein
Alias SymbolsMGC99675
NCBI Gene Id4155
Protein NameMyelin basic protein
Description of TargetThe classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. MBP induces T-cell proliferation.The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
Uniprot IDP02686
Protein Accession #NP_001020272
Nucleotide Accession #NM_001025101
Protein Size (# AA)304
Molecular Weight33kDa
Protein InteractionsCTDSP1; MAP3K3; UBC; PRKCB; MAPK3; MAPK1; ULK1; SQSTM1; PKN1; HIPK2; MNAT1; CDK9; CDK8; CDK7; CCNT1; CCNH; CCNC; MELK; DDX58; MAPK14; AT4G38520; AT4G31860; AT4G28400; ABI1; RPS6KA6; TOPP8; AT5G24940; AT5G10740; AT5G06750; AT3G17250; AT3G02750; AT3G15260;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
OKCD01521
 96Wells 
OKCD01524
 96Wells