Tmem120a Antibody Middle region

Cat# ARP96061_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-TMEM120A (ARP96061_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityRat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of rat TMEM120A
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: NGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFL
Concentration0.5 mg/ml
Blocking PeptideFor anti-TMEM120A (ARP96061_P050) antibody is Catalog # AAP96061
Gene SymbolTMEM120A
Gene Full Nametransmembrane protein 120A
Alias SymbolsTmp, Tmpit, 2010310D06Rik
NCBI Gene Id215210
Protein Nametransmembrane protein 120A
Description of TargetNecessary for efficient adipogenesis.
Uniprot IDQ5HZE2
Protein Accession #NP_766129.1
Nucleotide Accession #NM_172541.2
Protein Size (# AA)343
Molecular Weight41 kDa
  1. What is the species homology for "TMEM120A Antibody - middle region (ARP96061_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Rat".

  2. How long will it take to receive "TMEM120A Antibody - middle region (ARP96061_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "TMEM120A Antibody - middle region (ARP96061_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TMEM120A Antibody - middle region (ARP96061_P050)"?

    This target may also be called "Tmp, Tmpit, 2010310D06Rik" in publications.

  5. What is the shipping cost for "TMEM120A Antibody - middle region (ARP96061_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "TMEM120A Antibody - middle region (ARP96061_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TMEM120A Antibody - middle region (ARP96061_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TMEM120A Antibody - middle region (ARP96061_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TMEM120A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TMEM120A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TMEM120A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TMEM120A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TMEM120A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TMEM120A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.