Clinisciences > VDAC1 Antibody - C-terminal region
VDAC1 Antibody - C-terminal region
Cat# ARP35122_T100-25UL
Size : 25ul
Brand : Aviva Systems Biology
Bulk
Order
Order
Aviva's
Satisfaction
Guarantee
Satisfaction
Guarantee
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- : Antibody & Protein in US
- + /Kit in US
- Contact us for international orders.
Rating:
93% of 100
VDAC1 Antibody - C-terminal region (ARP35122_T100)
| Datasheets/Manuals | Printable datasheet for anti-VDAC1 (ARP35122_T100) antibody |
|---|
| Publications | ArduÃno, D. M. et al. Mitochondrial metabolism in Parkinsonâ, 4680-702 (2012). 22843496 Chen, S. et al. Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins. J. Proteome Res. 8, 5196-211 (2009). 19775189 Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). 23840483 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353) |
| Sample Type Confirmation | VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Zheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247 |
|---|---|
| Gene Symbol | VDAC1 |
| Gene Full Name | Voltage-dependent anion channel 1 |
| Alias Symbols | PORIN, VDAC-1 |
| NCBI Gene Id | 7416 |
| Protein Name | Voltage-dependent anion-selective channel protein 1 |
| Description of Target | The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis. |
| Uniprot ID | .toggleTablecontent{width: 100%} .tbl-grid{width: 100%;} .tbl-grid thead{background-color: #c9c2c2;}th{padding: 9px;}.toggleTablecontent td, th{padding: 16px;}.toggleTable{background-color: #53ac4e}tr.alt {background-color: #f6f6f6;}th.col.label{text-align: justify;}.additional-attributes-wrapper.table-wrapper{margin: 26px;}div#protocols\.data\.tab {margin: 26px;}
You might also be interested by the following products:
Cat#
Description
Cond.
Price Bef. VAT
|


