VDAC1 Antibody - C-terminal region

Cat# ARP35122_T100-25UL

Size : 25ul

Brand : Aviva Systems Biology


VDAC1 Antibody - C-terminal region (ARP35122_T100)

Datasheets/ManualsPrintable datasheet for anti-VDAC1 (ARP35122_T100) antibody
Product Info
Publications

Arduíno, D. M. et al. Mitochondrial metabolism in Parkinsonâ, 4680-702 (2012). 22843496

Chen, S. et al. Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins. J. Proteome Res. 8, 5196-211 (2009). 19775189

Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). 23840483

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Concentration1.0 mg/ml
Blocking PeptideFor anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353)
Sample Type Confirmation

VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

ReferenceZheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247
Gene SymbolVDAC1
Gene Full NameVoltage-dependent anion channel 1
Alias SymbolsPORIN, VDAC-1
NCBI Gene Id7416
Protein NameVoltage-dependent anion-selective channel protein 1
Description of TargetThe voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
Uniprot ID.toggleTablecontent{width: 100%} .tbl-grid{width: 100%;} .tbl-grid thead{background-color: #c9c2c2;}th{padding: 9px;}.toggleTablecontent td, th{padding: 16px;}.toggleTable{background-color: #53ac4e}tr.alt {background-color: #f6f6f6;}th.col.label{text-align: justify;}.additional-attributes-wrapper.table-wrapper{margin: 26px;}div#protocols\.data\.tab {margin: 26px;}

You might also be interested by the following products: