Wdfy1 Antibody - N-terminal region

Cat# ARP57466_P050-25UL

Size : 25ul

Brand : Aviva Systems Biology


Wdfy1 Antibody - N-terminal region (ARP57466_P050)

Datasheets/ManualsPrintable datasheet for anti-Wdfy1 (ARP57466_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC-FFPE
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA
Concentration0.5 mg/ml
Blocking PeptideFor anti-Wdfy1 (ARP57466_P050) antibody is Catalog # AAP57466
Enhanced Validation
Relative Expression (Western Blot)
Avivasheild
Gene SymbolWdfy1
Gene Full NameWD repeat and FYVE domain containing 1
Alias SymbolsJr, Jr1, WDF1, FENS-1, ZFYVE17, mKIAA1435, 1700013B03Rik, 1700120F24Rik
NCBI Gene Id69368
Protein NameProtein Wdfy1 Ensembl ENSMUSP00000109138 Ensembl ENSMUSP00000109139 Ensembl ENSMUSP00000040224
Description of TargetThe function of this protein remains unknown.
Uniprot IDQ9DAD3
Protein Accession #NP_081333
Nucleotide Accession #NM_027057
Protein Size (# AA)187
Molecular Weight46 kDa

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
ARP57466_P050
 100ul 
ARP57465_P050
 100ul 
ARP57465_P050-25UL
 25ul