Wdfy1 Antibody - N-terminal region
Cat# ARP57466_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
Wdfy1 Antibody - N-terminal region (ARP57466_P050)
| Datasheets/Manuals | Printable datasheet for anti-Wdfy1 (ARP57466_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC-FFPE |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Wdfy1 (ARP57466_P050) antibody is Catalog # AAP57466 |
| Enhanced Validation |
| Gene Symbol | Wdfy1 |
|---|---|
| Gene Full Name | WD repeat and FYVE domain containing 1 |
| Alias Symbols | Jr, Jr1, WDF1, FENS-1, ZFYVE17, mKIAA1435, 1700013B03Rik, 1700120F24Rik |
| NCBI Gene Id | 69368 |
| Protein Name | Protein Wdfy1 Ensembl ENSMUSP00000109138 Ensembl ENSMUSP00000109139 Ensembl ENSMUSP00000040224 |
| Description of Target | The function of this protein remains unknown. |
| Uniprot ID | Q9DAD3 |
| Protein Accession # | NP_081333 |
| Nucleotide Accession # | NM_027057 |
| Protein Size (# AA) | 187 |
| Molecular Weight | 46 kDa |





