ANKRD11 Antibody - N-terminal region - HRP
Cat# ARP33542_T100-HRP
Size : 100ul
Brand : Aviva Systems Biology
ANKRD11 Antibody - N-terminal region : HRP (ARP33542_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-ANKRD11 (ARP33542_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD11 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANKRD11 (ARP33542_T100-HRP) antibody is Catalog # AAP33542 (Previous Catalog # AAPP04593) |
| Reference | Zhang,A., et al., (2004) J. Biol. Chem. 279 (32), 33799-33805 |
|---|---|
| Gene Symbol | ANKRD11 |
| Gene Full Name | Ankyrin repeat domain 11 |
| Alias Symbols | T13, LZ16, ANCO1, ANCO-1 |
| NCBI Gene Id | 29123 |
| Protein Name | Nasopharyngeal carcinoma susceptibility protein LZ16 EMBL AAF24125.1; Ankyrin repeat domain 11 isoform A |
| Description of Target | ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases. |
| Uniprot ID | Q9UHR3, X5D778 |
| Protein Accession # | NP_037407 |
| Nucleotide Accession # | NM_013275 |
| Protein Size (# AA) | 2663 |
| Molecular Weight | 298kDa |
| Protein Interactions | LZTS2; CEP44; CDCA7L; HOOK2; TFIP11; IKZF1; PDE4DIP; BZRAP1; MKRN3; TRAF2; TRIM37; GOLGA2; HDAC3; UBC; HDAC5; NCOA2; HDAC4; RAC3; SRC; ANKRD11; NCOA3; NCOA1; |
