Anti-Human GATA2 Polyclonal Antibody

Cat# NB-21-37813

Size : 100µg

Brand : Neo Biotech


Anti-Human GATA2 Polyclonal Antibody

Product name ARO-A11715-100
Uniprot ID P23769
Raw Antigen Sequence PTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Host species Rabbit
Aliases /Synonyms Anti-GATA2, GATA-binding protein 2, Endothelial transcription factor GATA-2
Reference ARO-A11715
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human GATA2 (Pro175-Gly480).