Citrullinated amyloid-β (1-42) peptide (human)
Cat# HY-P5905-1mg
Size : 1mg
Brand : MedChemExpress
| Description |
Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets[1]. |
||||||
|---|---|---|---|---|---|---|---|
| Molecular Weight |
4515.02 |
||||||
| Formula |
C203H310N54O61S |
||||||
| Appearance |
Solid |
||||||
| Color |
White to off-white |
||||||
| Sequence |
Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
||||||
| Sequence Shortening |
DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
||||||
| Shipping | Room temperature in continental US; may vary elsewhere. |
||||||
| Storage |
Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Purity & Documentation | |||||||
| References |

