Reagents and instruments for immunology, cell biology and molecular biology.
 
> Estrogen receptor (in E.coli)

Estrogen receptor (in E.coli)

Print Print
Please log in

Cat# NB-21-24568

Size : 100ug

Brand : Neo Biotech


Estrogen receptor (in E.coli)

Product name Estrogen receptor (in E.coli)
Uniprot ID P03372
Uniprot link https://www.uniprot.org/uniprot/P03372
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight 29.47 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Met297-Ser554
Protein Accession P03372
Spec:Entrez GeneID 2099
Spec:NCBI Gene Aliases ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID Q9UIS7
NCBI Reference P03372
Aliases /Synonyms ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference PX-P4797
Note For research use only
Molecular Constructor
Met297–Ser554 N terminus His