IL8 / CXCL8, C-His, recombinant protein

Cat# NB-21-25932

Size : 100ug

Brand : Neo Biotech


IL8 / CXCL8, C-His, recombinant protein

Product name IL8 / CXCL8, C-His, recombinant protein
Uniprot ID P10145
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Molecular weight 9.89 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Ala23-Ser99
Protein Accession P10145
Reference PX-P5796
Note For research use only.
Molecular Constructor
Ala23–Ser99 His