NDK, cytosolic Protein, Dictyostelium discoideum, Recombinant (His & V5)
Cat# NB-64-49155-1mg
Size : 1mg
Brand : Neo Biotech
Remove All
NDK, cytosolic Protein, Dictyostelium discoideum, Recombinant (His & V5)
(Synonyms: Nucleoside diphosphate kinase, cytosolic, NDP kinase, ndkC-2, ndkC-1, ndkB, NDK, gip17, cytosolic) Copy Product InfoSynonyms: Nucleoside diphosphate kinase, cytosolic, NDP kinase, ndkC-2, ndkC-1, ndkB, NDK, gip17, cytosolic
Catalog No. TMPH-00477 Copy Product Info
NDK, cytosolic Protein, Dictyostelium discoideum, Recombinant (His & V5) is expressed in E. coli.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | NDK, cytosolic Protein, Dictyostelium discoideum, Recombinant (His & V5) is expressed in E. coli. |
| Species | Dictyostelium discoideum |
| Expression System | E. coli |
| Tag | N-10xHis-V5 |
| Accession Number | P22887 |
| Amino Acid | MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE |
| Construction | 1-155 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Nucleoside diphosphate kinase, cytosolic, NDP kinase, ndkC-2, ndkC-1, ndkB, NDK, gip17, cytosolic |
| Research Background | Major role in the synthesis of nucleoside triphosphates other than ATP. |
| Molecular Weight | 24.2 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
ndkC2ndkC1gip 17
Related Tags: NDK, cytosolic Protein, Dictyostelium discoideum, Recombinant (His & V5) chemical structure | NDK, cytosolic Protein, Dictyostelium discoideum, Recombinant (His & V5) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

