Reagents and instruments for immunology, cell biology and molecular biology.
 
> Recombinant Human CD49f/ITGA6 Protein, N-His

Recombinant Human CD49f/ITGA6 Protein, N-His

Print Print
Please log in

Cat# NB-21-32669

Size : 100µg

Brand : Neo Biotech


Recombinant Human CD49f/ITGA6 Protein, N-His

Product name ARO-P11200-100
Uniprot ID P23229
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLD
Molecular weight 63.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Val463-Asp1011
Aliases /Synonyms CD49 antigen-like family member F, Integrin alpha-6, ITGA6, VLA-6, CD49f, Alpha6p
Reference ARO-P11200
Note For research use only.
Molecular Constructor
Val463–Asp1011