Recombinant Human Cytokine receptor common subunit gamma (IL2RG), partial (Active)
Cat# orb2659150-1mg
Size : 1mg
Brand : Biorbyt
Recombinant Human Cytokine receptor common subunit gamma (IL2RG), partial (Active)
SKU: orb2659150
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IL2RG at 2 μg/mL can bind Anti-IL2RG recombinant antibody. The EC50 is 12.19-13.63 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 23-254aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 28.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-2 receptor subunit gamma (IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG); gammaC; p64; CD132
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



