Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial
Cat# orb1096238-100ug
Size : 100ug
Brand : Biorbyt
Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial
SKU: orb1096238
Description
Research Area
Neuroscience
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-KSI-tagged |
| Expression Region | 146-236aa |
| Protein Length | Partial |
| MW | 25.5 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Sodium-dependent glutamate/aspartate transporter 1, GLAST-1, Solute carrier family 1 member 3
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide