Recombinant Human SYNGAP1 Protein, N-His

Cat# NB-21-33581

Size : 100µg

Brand : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96PV0
Molecular weight:
15.79 kDa
Ser1186–His1277

Specifications Recombinant Human SYNGAP1 Protein, N-His

Product name ARO-P10382-100
Uniprot ID Q96PV0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight 15.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1186-His1277
Aliases /Synonyms Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference ARO-P10382
Note For research use only.
Molecular Constructor
Ser1186–His1277
Product name ARO-P10382-1MG
Uniprot ID Q96PV0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight 15.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1186-His1277
Aliases /Synonyms Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference ARO-P10382
Note For research use only.
Molecular Constructor
Ser1186–His1277
Product name ARO-P10382-50
Uniprot ID Q96PV0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDH
Molecular weight 15.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1186-His1277
Aliases /Synonyms Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, Neuronal RasGAP, SYNGAP1, KIAA1938, Ras/Rap GTPase-activating protein SynGAP
Reference ARO-P10382
Note For research use only.
Molecular Constructor
Ser1186–His1277

Documents

3D Representation

Recombinant Human SYNGAP1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human SYNGAP1 Protein, N-His” Cancel reply

Related products

  • Anti-Human SYNGAP1 (Ser1186-His1277) Polyclonal Antibody binds to Recombinant Human SYNGAP1 Protein, N-His in WB Assay

    ARO-A12767

    Anti-Human SYNGAP1 (Ser1186-His1277) Polyclonal Antibody