Recombinant IFN gamma (Interferon gamma), Swine, Animal-Free
Cat# orb1178905-5ug
Size : 5ug
Brand : Biorbyt
Recombinant IFN gamma (Interferon gamma), Swine, AF
DownloadView GuideView Protocol
Recombinant IFN gamma (Interferon gamma), Swine, Animal-Free
SKU: orb1178905
Description
Research Area
Infectious Disease & Virology; Immunology & Inflammation
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Origin | Swine |
| Biological Activity | Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <40 pg/mL. |
| Reactivity | Porcine |
| Tag | His-tag at the N-terminus |
| Endotoxins | <0.01 EU per 1 μg of the protein by the LAL method. |
| Purity | >95% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK with polyhistidine tag at the C-terminus. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
Recombinant IFN gamma (Interferon gamma), Swine, Animal-Free (orb1178905)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

