Recombinant Mouse NODAL Protein, N-His

Cat# NB-21-32820

Size : 100µg

Brand : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P43021
Molecular weight:
20.93 kDa
Ser40–Asn203

Specifications Recombinant Mouse NODAL Protein, N-His

Product name ARO-P11049-100
Uniprot ID P43021
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Molecular weight 20.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser40-Asn203
Aliases /Synonyms Nodal
Reference ARO-P11049
Note For research use only.
Molecular Constructor
Ser40–Asn203
Product name ARO-P11049-1MG
Uniprot ID P43021
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Molecular weight 20.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser40-Asn203
Aliases /Synonyms Nodal
Reference ARO-P11049
Note For research use only.
Molecular Constructor
Ser40–Asn203
Product name ARO-P11049-50
Uniprot ID P43021
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Molecular weight 20.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser40-Asn203
Aliases /Synonyms Nodal
Reference ARO-P11049
Note For research use only.
Molecular Constructor
Ser40–Asn203

Description

Introduction

Recombinant Mouse NODAL Protein is a type of protein that has been produced through genetic engineering techniques. It is a member of the TGF-β superfamily and is involved in various biological processes such as cell differentiation, proliferation, and migration. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse NODAL Protein.

Structure of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein is a homodimeric protein, meaning it is composed of two identical subunits. Each subunit has a molecular weight of approximately 40 kDa and is made up of 347 amino acids. The protein contains a signal peptide at the N-terminus, followed by a prodomain and a mature domain. The mature domain is responsible for the biological activity of the protein.

The crystal structure of Recombinant Mouse NODAL Protein has been determined, revealing a compact structure with a central core composed of seven beta strands surrounded by alpha helices. The structure of this protein is highly conserved among different species, indicating its importance in various biological processes.

Activity of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein is a multifunctional protein that plays a crucial role in embryonic development. It acts as a morphogen, meaning it can induce different cell fates depending on its concentration. NODAL signaling is essential for mesoderm and endoderm formation during early embryonic development. It also plays a role in left-right axis determination and neural tube patterning.

In addition to its role in embryonic development, NODAL signaling has been found to be involved in cancer progression. It has been shown to promote tumor growth, invasion, and metastasis in various types of cancer. This makes Recombinant Mouse NODAL Protein a potential target for cancer therapy.

Applications of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein has various applications in both research and clinical settings. In research, it is commonly used to study embryonic development and stem cell differentiation. It can also be used to induce pluripotency in somatic cells, making it a valuable tool in the field of regenerative medicine.

In a clinical setting, Recombinant Mouse NODAL Protein has potential therapeutic applications. Its ability to induce pluripotency in somatic cells can be utilized for cell-based therapies. It is also being studied as a potential target for cancer therapy, with the aim of inhibiting its activity to prevent tumor growth and metastasis.

Antigenic Properties of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein can act as an antigen, meaning it can elicit an immune response in the body. This property has been utilized in the development of vaccines against certain types of cancer. The protein can be used as a vaccine antigen to induce an immune response against cancer cells expressing NODAL, leading to their destruction.

In addition, Recombinant Mouse NODAL Protein can also be used as a diagnostic tool for various diseases. Antibodies against NODAL can be used to detect its expression in tissues, providing valuable information for disease diagnosis and prognosis.

Conclusion

In summary, Recombinant Mouse NODAL Protein is a crucial protein involved in embryonic development and cancer progression. Its structure and activity have been extensively studied, and it has various applications in research and clinical settings. With ongoing research, this protein has the potential to be used as a therapeutic target for cancer and other diseases.

Documents

3D Representation

Recombinant Mouse NODAL Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Mouse NODAL Protein, N-His” Cancel reply

Related products

  • SDS-PAGE for Anti-Human NODAL Antibody (ABS1231)

    ARO-A17575

    Anti-Human NODAL Antibody (ABS1231)