Recombinant Pseudomonas aeruginosa Pseudolysin(lasB),partial

Cat# orb1631298-1mg

Size : 1mg

Brand : Biorbyt


Recombinant Pseudomonas aeruginosa Pseudolysin(lasB),partial

SKU: orb1631298

Description

Recombinant Pseudomonas aeruginosa Pseudolysin(lasB),partial

Images & Validation

Key Properties

Expression SystemE.coli
TagN-terminal 6xHis-SUMO-tagged
Expression Region198-498aa (AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL)
MW49.1 kDa
PurityGreater than 90% as determined by SDS-PAGE.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceTris-based buffer50% glycerol
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Neutral metalloproteinase PAE Pseudolysin Cleaved into the following chain: Pro-elastase

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT