Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial, Fluorescent-VLPs
Cat# orb2658163-100ug
Size : 100ug
Brand : Biorbyt
Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1), partial, Fluorescent-VLPs
SKU: orb2658163
Description
Research Area
Neuroscience
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Tag | C-terminal EGFP-tagged |
| Expression Region | 396-800aa |
| Protein Length | Partial |
| MW | 73.3 kDa |
| Purity | The purity information is not available for VLPs proteins. |
| Protein Sequence | TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−GluN1;Glutamate [NMDA] receptor subunit zeta-1;N-methyl-D-aspartate receptor subunit NR1;NMD-R1
−
Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1) (F484A,T518A,R523A,W731A), partial, Fluorescent-VLPs [orb2658155]
The purity information is not available for VLPs proteins.
73.0 kDa
Mammalian cell
1 mg, 100 μg, 20 μg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide




