Vaccinia virus OPG190 Protein (His)
Cat# NB-64-127667-10ug
Size : 10ug
Brand : Neo Biotech
Remove All
Vaccinia virus OPG190 Protein (His)
(Synonyms: Protein OPG190, Plaque-size/host range protein, B5R) Copy Product InfoSynonyms: Protein OPG190, Plaque-size/host range protein, B5R
Catalog No. TMPH-04372 Copy Product Info
Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4. |
| Species | Vaccinia virus |
| Expression System | in vitro E. coli expression system |
| Tag | N-10xHis |
| Accession Number | Q80KX4 |
| Amino Acid | MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP |
| Construction | 1-317 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Protein OPG190, Plaque-size/host range protein, B5R |
| Molecular Weight | 41.2 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Vaccinia virus OPG190 Protein (His) chemical structure | Vaccinia virus OPG190 Protein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

