Anti-HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA) (MaxLight 650) Polyclonal Antibody
Cat# 127898-ML650-100ul
Size : 100ul
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
127898-ML650 HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA) (MaxLight 650)
Clone Type
PolyclonalHost
rabbitSource
humanIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_002116, NP_002107.3Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Involved in the presentation of foreign antigens to the immune system.
Applications:
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.