Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His)
Cat# NB-64-50126-10ug
Size : 10ug
Brand : Neo Biotech
Remove All
Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His)
(Synonyms: U27, Polymerase accessory protein (PAP), Phosphoprotein P41 (PP41), EPLF1, DNA polymerase processivity factor) Copy Product InfoSynonyms: U27, Polymerase accessory protein (PAP), Phosphoprotein P41 (PP41), EPLF1, DNA polymerase processivity factor
Catalog No. TMPH-01450 Copy Product Info
Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) is expressed in Yeast.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) is expressed in Yeast. |
| Species | HHV-6A |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P52439 |
| Amino Acid | MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV |
| Construction | 1-393 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | U27, Polymerase accessory protein (PAP), Phosphoprotein P41 (PP41), EPLF1, DNA polymerase processivity factor |
| Research Background | Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization. |
| Molecular Weight | 46.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
U 27PP-41PP41PAPEPLF 1
Related Tags: Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) chemical structure | Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

